PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.313950.1
Common NameCsa_3G914600, LOC101214098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 254aa    MW: 28517.7 Da    PI: 9.3784
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.313950.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-141764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ed++l +++  +G g+W++ +++ g+ R +k+c++rw +yl
   Cucsa.313950.1 17 KGLWSPDEDQRLRNYILNYGHGCWSSLPSKAGLERNGKSCRLRWINYL 64
                     678*******************************************97 PP

2Myb_DNA-binding47.63.9e-1570115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++++E+  ++ ++++lG++ W+ Ia++++ gRt++++k+ w++yl
   Cucsa.313950.1  70 RGTFSQQEQHTILSLHHMLGNK-WSQIAQHLP-GRTDNEVKNLWHSYL 115
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-211267IPR009057Homeodomain-like
PROSITE profilePS5129415.0631264IPR017930Myb domain
SuperFamilySSF466894.03E-2715111IPR009057Homeodomain-like
SMARTSM007175.7E-101666IPR001005SANT/Myb domain
PfamPF002493.0E-121764IPR001005SANT/Myb domain
CDDcd001671.13E-82064No hitNo description
PROSITE profilePS5129423.98865119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2468119IPR009057Homeodomain-like
SMARTSM007171.8E-1169117IPR001005SANT/Myb domain
PfamPF002491.4E-1470115IPR001005SANT/Myb domain
CDDcd001671.63E-772114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVRETTASHR TKSKHRKGLW SPDEDQRLRN YILNYGHGCW SSLPSKAGLE RNGKSCRLRW  60
INYLRPGLKR GTFSQQEQHT ILSLHHMLGN KWSQIAQHLP GRTDNEVKNL WHSYLKKKLD  120
KQQQKQAYHS STNSTTSDSA DSSTTNPSIH SPIPNNNISQ LPKLFFAEWL TVGSSSNGGS  180
EFGPSTTNNL IGQPNFEFGM SLGSELLQNN GIIMDSHVKF EDHHISNGFA NYASDGDVCV  240
EHLLHFGNGF MNI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24171207109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148377.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K45e-59LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0A0LEM10.0A0A0A0LEM1_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s13190.17e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.15e-55myb domain protein 45
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]